CacheBy
Atlas Antibodies Anti-LZTR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LZTR1 Antibody

상품 한눈에 보기

Human LZTR1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. 인체 반응성이 검증되었으며, 40% glycerol/PBS 버퍼에 보존됩니다.

카탈로그번호
HPA071248-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA071248-100 Anti-LZTR1 Antibody, leucine-zipper-like transcription regulator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071248-25 Anti-LZTR1 Antibody, leucine-zipper-like transcription regulator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LZTR1 Antibody

Anti-LZTR1 Antibody

Target: leucine zipper like transcription regulator 1 (LZTR1)
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human LZTR1.


Alternative Gene Names

  • BTBD29
  • LZTR-1

Open Datasheet


Target Information

항목 내용
Target Protein leucine zipper like transcription regulator 1
Target Gene LZTR1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000001870 (95%)
Mouse ENSMUSG00000022761 (95%)

Antigen Sequence:
TQPASELPSGRLFHAAAVISDAMYIFGGTVDNNIRSGEMYRFQFSCYPKCTLHEDYGRLWESRQFCDVEFVLGEKEECVQGHVAIVTA


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.