Thermo Fisher Scientific Neuroserpin Polyclonal Antibody
Neuroserpin 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. 인간, 마우스, 랫트 반응성. Western blot에 적합하며, 항원 친화 크로마토그래피로 정제됨. 신경 성장 및 시냅스 가소성 연구에 활용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Neuroserpin (272–310aa: KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKAL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747096 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain and preferentially inhibits tissue-type plasminogen activator. It plays a role in regulating axonal growth and synaptic plasticity.
Mutations in this gene cause familial encephalopathy with neuroserpin inclusion bodies (FENIB), a dominantly inherited form of encephalopathy and epilepsy characterized by accumulation of mutant neuroserpin polymers.
Multiple alternatively spliced variants encoding the same protein have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific PAI1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SF1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Neuroserpin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Maspin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SETDB1 Polyclonal Antibody
514,100원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|