Thermo Fisher Scientific Neuroserpin Polyclonal Antibody
Neuroserpin 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. 인간, 마우스, 랫트 반응성. Western blot에 적합하며, 항원 친화 크로마토그래피로 정제됨. 신경 성장 및 시냅스 가소성 연구에 활용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Neuroserpin Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Neuroserpin (272–310aa: KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKAL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747096 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain and preferentially inhibits tissue-type plasminogen activator. It plays a role in regulating axonal growth and synaptic plasticity.
Mutations in this gene cause familial encephalopathy with neuroserpin inclusion bodies (FENIB), a dominantly inherited form of encephalopathy and epilepsy characterized by accumulation of mutant neuroserpin polymers.
Multiple alternatively spliced variants encoding the same protein have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.