Thermo Fisher Scientific LIMK1 Polyclonal Antibody
LIMK1 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체. 사람, 생쥐, 랫트 반응성. Western blot에 적합하며, 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며 -20°C 보관.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific LIMK1 Polyclonal Antibody
Thermo Fisher Scientific LIMK1 Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
- View 1 publication
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to the C-terminus of human LIMK1 (599–634aa KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746718 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
LIMK1 is a serine/threonine kinase involved in regulation of actin cytoskeletal changes via phosphorylation of cofilin. LIMK1 has also been implicated in brain development. LIM domains are highly conserved cysteine-rich structures containing two zinc fingers that mediate protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with two N-terminal LIM motifs and a C-terminal kinase domain. LIMK1 hemizygosity is associated with visuospatial cognitive impairment in Williams syndrome.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
- PA5-79603_LIMK1_P53667-1_Rabbit.svg
- PA5-79603_LIMK1_P53667-1_Rabbit_PDP.jpeg
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.