Thermo Fisher Scientific LIMK1 Polyclonal Antibody
LIMK1 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체. 사람, 생쥐, 랫트 반응성. Western blot에 적합하며, 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며 -20°C 보관.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific LIMK1 Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
- View 1 publication
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to the C-terminus of human LIMK1 (599–634aa KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746718 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
LIMK1 is a serine/threonine kinase involved in regulation of actin cytoskeletal changes via phosphorylation of cofilin. LIMK1 has also been implicated in brain development. LIM domains are highly conserved cysteine-rich structures containing two zinc fingers that mediate protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with two N-terminal LIM motifs and a C-terminal kinase domain. LIMK1 hemizygosity is associated with visuospatial cognitive impairment in Williams syndrome.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
- PA5-79603_LIMK1_P53667-1_Rabbit.svg
- PA5-79603_LIMK1_P53667-1_Rabbit_PDP.jpeg
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Lamin A/C Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Lamin A/C Polyclonal Antibody
565,000원
Thermo Fisher Scientific
Thermo Fisher Scientific LIMK1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific LIFR Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific LIF Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|