원본

Thermo Fisher Scientific LIFR Polyclonal Antibody

상품 한눈에 보기

Human LIFR 단백질을 인식하는 Rabbit Polyclonal 항체로, Western Blot에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다. 재구성 시 500 µg/mL 농도로 사용 가능하며, 연구용으로만 사용됩니다.

브랜드: Thermo Fisher Scientific
카테고리: Polyclonal Antibodies
판매단위: pk

카탈로그

1개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

마지막 업데이트 2025. 08. 04. 오전 10:01

카탈로그 번호 · 상품 설명출고판매가담기

Thermo Fisher Scientific PA579602 LIFR Polyclonal Antibody 100 ug pk판매 단위 pk ·

재고 확인 필요재고 확인 필요

568,000원VAT 포함 624,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Thermo Fisher Scientific · Thermo Fisher Scientific LIFR Polyclonal Antibody

Applications

Western Blot (WB)

Tested Dilution: 0.1–0.5 µg/mL

Product Specifications

항목	내용
Species Reactivity	Human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human LIFR (863–899aa: EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE)
Conjugate	Unconjugated
Form	Lyophilized
Concentration	500 µg/mL
Purification	Antigen affinity chromatography
Storage buffer	PBS with 5 mg BSA
Contains	0.05 mg sodium azide
Storage conditions	-20°C
Shipping conditions	Ambient (domestic); Wet ice (international)
RRID	AB_2746717

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Signal-transducing molecule that may share a common pathway with IL6ST.
The soluble form inhibits the biological activity of LIF by blocking its binding to receptors on target cells.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

Thermo Fisher ScientificThermo Fisher Scientific Lamin A/C Polyclonal Antibody565,000원VAT별도

Thermo Fisher ScientificThermo Fisher Scientific LIMK1 Polyclonal Antibody568,000원VAT별도

Thermo Fisher ScientificThermo Fisher Scientific LIF Polyclonal Antibody568,000원VAT별도

문의

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.