
Thermo Fisher Scientific SMYD3 Polyclonal Antibody
SMYD3 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체입니다. Western blot과 IHC(P) 실험에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 -20°C에서 보관합니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human SMYD3 (388–428aa QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747160 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
SMYD3 (histone-lysine N-methyltransferase) methylates Lys-4 of histone H3 and Lys-5 of histone H4, inducing di- and tri-methylation.
SMYD3 plays an important role in transcriptional activation as a member of an RNA polymerase complex.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지

🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific SNRPN Polyclonal Antibody
668,200원

Thermo Fisher Scientific
Thermo Fisher Scientific SMC3 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific SMYD3 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific SOD2 (MnSOD) Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific SMURF2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|