CacheBy
Thermo Fisher Scientific SMYD3 Polyclonal Antibody
원본

Thermo Fisher Scientific SMYD3 Polyclonal Antibody

상품 한눈에 보기

SMYD3 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체입니다. Western blot과 IHC(P) 실험에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 -20°C에서 보관합니다. 연구용으로만 사용 가능합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오전 05:43
Thermo Fisher Scientific PA580045 SMYD3 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific SMYD3 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL

Immunohistochemistry (Paraffin) (IHC (P))

  • Tested Dilution: 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human SMYD3 (388–428aa QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions −20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2747160

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

SMYD3 (histone-lysine N-methyltransferase) methylates Lys-4 of histone H3 and Lys-5 of histone H4, inducing di- and tri-methylation.
SMYD3 plays an important role in transcriptional activation as a member of an RNA polymerase complex.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

SMYD3 Immunogen Diagram
SMYD3 Immunogen PDP

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.