Thermo Fisher Scientific SMURF2 Polyclonal Antibody
SMURF2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체. Western blot에 최적화되어 있으며 Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제된 고순도 제품. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific SMURF2 Polyclonal Antibody
Applications
- Western Blot (WB): Tested dilution 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human SMURF2 (317–351aa DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | −20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747159 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
SMURF2 is an E3 ubiquitin-protein ligase that transfers ubiquitin from an E2 conjugating enzyme to target substrates. It interacts with SMAD1, SMAD2, and SMAD7 to trigger their ubiquitination and proteasome-dependent degradation. SMURF2 enhances SMAD7 inhibitory activity and reduces SMAD2 transcriptional activity. Coexpression with SMAD1 results in a significant decrease in SMAD1 protein levels and a smaller decrease in SMAD2 levels.
Usage Note
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SMYD3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SOD2 (MnSOD) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SMURF2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SMN1/SMN2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SMAD5 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|