Thermo Fisher Scientific SMURF2 Polyclonal Antibody
SMURF2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체. Western blot에 최적화되어 있으며 Human, Mouse, Rat 반응성. 항원 친화 크로마토그래피로 정제된 고순도 제품. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific SMURF2 Polyclonal Antibody
Thermo Fisher Scientific SMURF2 Polyclonal Antibody
Applications
- Western Blot (WB): Tested dilution 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human SMURF2 (317–351aa DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | −20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747159 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
SMURF2 is an E3 ubiquitin-protein ligase that transfers ubiquitin from an E2 conjugating enzyme to target substrates. It interacts with SMAD1, SMAD2, and SMAD7 to trigger their ubiquitination and proteasome-dependent degradation. SMURF2 enhances SMAD7 inhibitory activity and reduces SMAD2 transcriptional activity. Coexpression with SMAD1 results in a significant decrease in SMAD1 protein levels and a smaller decrease in SMAD2 levels.
Usage Note
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.