원본
Thermo Fisher Scientific SP5 Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 SP5 Polyclonal Antibody는 인간 SP5 단백질을 인식하는 토끼 유래 다클론 항체입니다. Western blot 및 IHC(P)에서 검증되었으며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 시 500 µg/mL 농도를 제공합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 07:15
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA580060 SP5 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific SP5 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Sp5 (246–275aa DFAQYQSQIAALLQTKAPLAATARRCRRCR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747175 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
SP5 binds to GC box promoter elements. It is a probable transcriptional activator involved in coordinating transcriptional changes required for pattern formation during embryonic development.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific SP4 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SP6 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SP3 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SP2 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.