
Atlas Antibodies Anti-ANGEL2 Antibody
상품 한눈에 보기
Human ANGEL2 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 연구용 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 서열 유사성을 보입니다. 안정한 PBS/glycerol 버퍼에 보존제를 포함합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ANGEL2 Antibody
Target Information
- Target Protein: angel homolog 2
- Target Gene: ANGEL2
- Alternative Gene Names: Ccr4d, FLJ12793, KIAA0759L
Recommended Applications
면역세포화학 (ICC)
Product Description
Polyclonal Antibody against Human ANGEL2
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
EGDEPSSKRRKHQGVIKRNWEYICSHDKEKTKILGDKNVDPKCEDSENKFDFSVMSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIK
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000026634 | 85% |
| Rat | ENSRNOG00000003795 | 84% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ANGPTL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANGPT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANGEL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANAPC5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANGPT1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.