Atlas Antibodies Anti-ANGPT1 Antibody

상품 한눈에 보기

Human ANGPT1 단백질을 인식하는 폴리클로날 항체로, IHC Orthogonal 검증을 통해 단백질 발현을 RNA-seq 데이터와 비교 확인 가능. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human 반응성 확인 및 Rat, Mouse 간 교차 반응성 정보 제공.

카탈로그번호: HPA018816-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA018816-100 Anti-ANGPT1 Antibody, angiopoietin 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA018816-25 Anti-ANGPT1 Antibody, angiopoietin 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ANGPT1 Antibody

Anti-ANGPT1 Antibody

Target Protein: angiopoietin 1
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human ANGPT1.

Alternative Gene Names

Ang1, KIAA0003

Open Datasheet

Specifications

항목	내용
Target Protein	angiopoietin 1
Target Gene	ANGPT1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	EKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFR
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000005854 (93%), Mouse ENSMUSG00000022309 (90%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.