CacheBy
Atlas Antibodies Anti-ANAPC5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ANAPC5 Antibody

상품 한눈에 보기

Human ANAPC5 단백질을 인식하는 Rabbit Polyclonal 항체로 IHC 및 WB에 적합합니다. ANAPC5(Anaphase Promoting Complex Subunit 5) 타깃에 특이적이며, Human, Mouse, Rat에서 반응합니다. PrEST 항원으로 정제된 고품질 항체입니다.

카탈로그번호
HPA039457-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039457-100 Anti-ANAPC5 Antibody, anaphase promoting complex subunit 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039457-25 Anti-ANAPC5 Antibody, anaphase promoting complex subunit 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ANAPC5 Antibody

Anti-ANAPC5 Antibody

Target: Anaphase Promoting Complex Subunit 5

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human ANAPC5.

Alternative Gene Names

  • APC5

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Anaphase promoting complex subunit 5
Target Gene ANAPC5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000001316 (98%), Mouse ENSMUSG00000029472 (98%)

Antigen Sequence:

LSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLR

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol, PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.