CacheBy
Atlas Antibodies Anti-ALKBH2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALKBH2 Antibody

상품 한눈에 보기

인간 ALKBH2 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광(ICC) 등에 사용 가능. PrEST 항원을 이용해 친화 정제됨. 높은 특이성과 재현성을 제공하며, 다양한 종에서 교차 반응성 검증됨.

카탈로그번호
HPA045392-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045392-100 Anti-ALKBH2 Antibody, alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045392-25 Anti-ALKBH2 Antibody, alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALKBH2 Antibody

Anti-ALKBH2 Antibody

Target Protein: alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ALKBH2.


Alternative Gene Names

  • ABH2
  • MGC90512

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase
Target Gene ALKBH2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence DDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRK
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000044339 (89%), Rat ENSRNOG00000028584 (88%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.