
Atlas Antibodies Anti-ALKBH2 Antibody
상품 한눈에 보기
인간 ALKBH2 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광(ICC) 등에 사용 가능. PrEST 항원을 이용해 친화 정제됨. 높은 특이성과 재현성을 제공하며, 다양한 종에서 교차 반응성 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ALKBH2 Antibody
Target Protein: alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human ALKBH2.
Alternative Gene Names
- ABH2
- MGC90512
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase |
| Target Gene | ALKBH2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRK |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000044339 (89%), Rat ENSRNOG00000028584 (88%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 항목 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ALKBH6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALKBH2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALKBH2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALKBH1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALKAL1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.