
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ALKBH2 Antibody
상품 한눈에 보기
Human ALKBH2 단백질을 인식하는 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. 40% glycerol과 PBS buffer로 안정화되어 장기 보관 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051976-100 Anti-ALKBH2 Antibody, alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051976-25 Anti-ALKBH2 Antibody, alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ALKBH2 Antibody
Anti-ALKBH2 Antibody
Target Protein: alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학 (ICC) 등 다양한 면역학적 분석에 사용 가능
Product Description
Polyclonal Antibody against Human ALKBH2
Alternative Gene Names
- ABH2
- MGC90512
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase |
| Target Gene | ALKBH2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000044339 (89%), Rat ENSRNOG00000028584 (88%) |
Antigen Sequence:
DDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRK
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



