CacheBy
Atlas Antibodies Anti-ALKBH2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALKBH2 Antibody

상품 한눈에 보기

Human ALKBH2 단백질을 인식하는 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. 40% glycerol과 PBS buffer로 안정화되어 장기 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051976-100 Anti-ALKBH2 Antibody, alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051976-25 Anti-ALKBH2 Antibody, alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALKBH2 Antibody

Anti-ALKBH2 Antibody

Target Protein: alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase
Supplier: Atlas Antibodies

면역세포화학 (ICC) 등 다양한 면역학적 분석에 사용 가능

Product Description

Polyclonal Antibody against Human ALKBH2

Alternative Gene Names

  • ABH2
  • MGC90512

Open Datasheet

Target Information

항목 내용
Target Protein alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase
Target Gene ALKBH2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000044339 (89%), Rat ENSRNOG00000028584 (88%)

Antigen Sequence:
DDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRK

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.