Atlas Antibodies Anti-ALKBH1 Antibody

상품 한눈에 보기

인간 ALKBH1 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화정제되었습니다. 인간에 특이적이며 쥐와 생쥐와 74% 서열 유사성을 보입니다. 안정한 PBS 버퍼에 보존되어 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA060061-100 Anti-ALKBH1 Antibody, alkB homolog 1, histone H2A dioxygenase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA060061-25 Anti-ALKBH1 Antibody, alkB homolog 1, histone H2A dioxygenase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: alkB, alkylation repair homolog 1 (E. coli)
Supplier: Atlas Antibodies

Polyclonal antibody against human ALKBH1.

ABH, alkB, ALKBH, hABH

항목	내용
Target Protein	alkB, alkylation repair homolog 1 (E. coli)
Target Gene	ALKBH1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN
Verified Species Reactivity	Human
Interspecies Homology	Rat ENSRNOG00000012264 (74%), Mouse ENSMUSG00000079036 (74%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet