AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRRC59 Antibody
상품 한눈에 보기
Human LRRC59 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Rabbit 호스트에서 제조되었으며, PrEST 항원으로 정제됨. Human, Mouse, Rat 종에 반응하며 높은 항원 서열 일치율을 가짐.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030827-100 Anti-LRRC59 Antibody, leucine rich repeat containing 59 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030827-25 Anti-LRRC59 Antibody, leucine rich repeat containing 59 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRRC59 Antibody
Anti-LRRC59 Antibody
Target: leucine rich repeat containing 59 (LRRC59)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human LRRC59
Alternative Gene Names
FLJ21675, PRO1855
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich repeat containing 59 |
| Target Gene | LRRC59 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000020869 (93%), Rat ENSRNOG00000059189 (93%) |
Antigen Sequence:
CRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWVLQTDSQQ
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.