
Atlas Antibodies Anti-LRRC59 Antibody
상품 한눈에 보기
Human LRRC59 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Rabbit 호스트에서 제조되었으며, PrEST 항원으로 정제됨. Human, Mouse, Rat 종에 반응하며 높은 항원 서열 일치율을 가짐.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LRRC59 Antibody
Target: leucine rich repeat containing 59 (LRRC59)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent validation)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human LRRC59
Alternative Gene Names
FLJ21675, PRO1855
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich repeat containing 59 |
| Target Gene | LRRC59 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000020869 (93%), Rat ENSRNOG00000059189 (93%) |
Antigen Sequence:
CRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWVLQTDSQQ
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LRRC6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC63 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC59 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC59 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC57 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.