CacheBy
Atlas Antibodies Anti-LRRC57 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRC57 Antibody

상품 한눈에 보기

Human LRRC57 단백질을 표적으로 하는 폴리클로날 항체. IHC, WB(재조합 발현 검증), ICC에 적합. Rabbit 유래 IgG 형식으로 PrEST 항원 친화 정제. 인간 반응성 검증 완료, glycerol/PBS buffer 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040894-100 Anti-LRRC57 Antibody, leucine rich repeat containing 57 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040894-25 Anti-LRRC57 Antibody, leucine rich repeat containing 57 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRC57 Antibody

Anti-LRRC57 Antibody

Target: leucine rich repeat containing 57 (LRRC57)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Recombinant expression validation using target protein overexpression
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human LRRC57.


Alternative Gene Names

  • FLJ36812

Open Datasheet


Target Information

항목 내용
Target Protein leucine rich repeat containing 57
Target Gene LRRC57
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000027286 95%
Rat ENSRNOG00000048310 94%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.