
Atlas Antibodies Anti-LRRC57 Antibody
상품 한눈에 보기
Human LRRC57 단백질을 표적으로 하는 폴리클로날 항체. IHC, WB(재조합 발현 검증), ICC에 적합. Rabbit 유래 IgG 형식으로 PrEST 항원 친화 정제. 인간 반응성 검증 완료, glycerol/PBS buffer 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LRRC57 Antibody
Target: leucine rich repeat containing 57 (LRRC57)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Recombinant expression validation using target protein overexpression
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human LRRC57.
Alternative Gene Names
- FLJ36812
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich repeat containing 57 |
| Target Gene | LRRC57 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTL |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000027286 | 95% |
| Rat | ENSRNOG00000048310 | 94% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LRRC59 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC59 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC57 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC63 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC58 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.