Atlas Antibodies Anti-LRRC59 Antibody

상품 한눈에 보기

인간 LRRC59 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화정제되었습니다. 인간, 생쥐, 랫트에 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030829-100 Anti-LRRC59 Antibody, leucine rich repeat containing 59 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030829-25 Anti-LRRC59 Antibody, leucine rich repeat containing 59 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: leucine rich repeat containing 59 (LRRC59)
Supplier: Atlas Antibodies

Validation Note:
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human LRRC59.

FLJ21675, PRO1855

항목	내용
Target Protein	leucine rich repeat containing 59
Target Gene	LRRC59
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	CRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWVLQTDSQQ

Human, Mouse, Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand