
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRRC3C Antibody
상품 한눈에 보기
Human LRRC3C 단백질에 대한 토끼 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인체 반응성이 검증되어 신뢰성 높은 결과를 지원.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA071271-100 Anti-LRRC3C Antibody, leucine rich repeat containing 3C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071271-25 Anti-LRRC3C Antibody, leucine rich repeat containing 3C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRRC3C Antibody
Anti-LRRC3C Antibody
Target: Leucine rich repeat containing 3C (LRRC3C)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human LRRC3C protein.
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence: YVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV
Species Reactivity
- Verified: Human
- Ortholog Identity:
- Rat ENSRNOG00000031298 (79%)
- Mouse ENSMUSG00000086545 (79%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Storage | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



