
Atlas Antibodies Anti-LRRC3C Antibody
상품 한눈에 보기
Human LRRC3C 단백질에 대한 토끼 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인체 반응성이 검증되어 신뢰성 높은 결과를 지원.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LRRC3C Antibody
Target: Leucine rich repeat containing 3C (LRRC3C)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human LRRC3C protein.
Antigen Information
- Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence: YVWQNRDETRRSLKRAPVLPVRSEDSSILSTVV
Species Reactivity
- Verified: Human
- Ortholog Identity:
- Rat ENSRNOG00000031298 (79%)
- Mouse ENSMUSG00000086545 (79%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Storage | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Material Safety Data Sheet (MSDS)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LRRC4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC39 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC3C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC37A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC37B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.