CacheBy
Atlas Antibodies Anti-LRRC4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRC4 Antibody

상품 한눈에 보기

Human LRRC4 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 연구용으로 적합. PrEST 항원을 이용해 친화 정제되었으며, 인체 반응성이 검증됨. 40% 글리세롤 및 PBS 완충액에 보존 처리됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051100-100 Anti-LRRC4 Antibody, leucine rich repeat containing 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051100-25 Anti-LRRC4 Antibody, leucine rich repeat containing 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRC4 Antibody

Anti-LRRC4 Antibody

Target: Leucine Rich Repeat Containing 4 (LRRC4)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human LRRC4 protein.

Alternative Gene Names

  • NAG14
  • Immunocytochemistry (ICC)

Target Information

항목 내용
Target Protein Leucine rich repeat containing 4
Target Gene LRRC4
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000008098 (100%)
Mouse ENSMUSG00000049939 (100%)

Antigen Information

  • Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence: APSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQE

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.