CacheBy
Atlas Antibodies Anti-LRRC37A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRC37A2 Antibody

상품 한눈에 보기

Human LRRC37A2 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit 호스트에서 생산됨. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human에 반응성이 검증된 고품질 연구용 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049080-100 Anti-LRRC37A2 Antibody, leucine rich repeat containing 37, member A2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049080-25 Anti-LRRC37A2 Antibody, leucine rich repeat containing 37, member A2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRC37A2 Antibody

Anti-LRRC37A2 Antibody

Target: leucine rich repeat containing 37, member A2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human LRRC37A2.


Alternative Gene Names

  • FLJ45049

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein leucine rich repeat containing 37, member A2
Target Gene LRRC37A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000042833 (63%), Mouse ENSMUSG00000034239 (51%)

Antigen Sequence:
AKSLINSPSQGAFSSLGDLSPQENPFLEVSAPSEH


Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.