Atlas Antibodies Anti-AGA Antibody
상품 한눈에 보기
인간 AGA 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터를 활용한 오쏘고날 검증 제공. 토끼 유래 IgG 형식이며 PrEST 항원으로 친화 정제됨. 인간에 반응하며 마우스·랫과 높은 서열 유사성 보유. PBS/glycerol 완충액에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AGA Antibody
Target Information
- Target Protein: Aspartylglucosaminidase
- Target Gene: AGA
- Alternative Gene Names: ASRG
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human AGA.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SSPLPLVVNTWPFKNATEAAWRALASGGSALDAVESGCAMCEREQCDGSV
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000031521 | 86% |
| Rat | ENSRNOG00000000108 | 84% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.