Atlas Antibodies Anti-AGA Antibody

상품 한눈에 보기

인간 AGA 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터를 활용한 오쏘고날 검증 제공. 토끼 유래 IgG 형식이며 PrEST 항원으로 친화 정제됨. 인간에 반응하며 마우스·랫과 높은 서열 유사성 보유. PBS/glycerol 완충액에 보존제 포함.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031415-100 Anti-AGA Antibody, aspartylglucosaminidase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031415-25 Anti-AGA Antibody, aspartylglucosaminidase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-AGA Antibody

Anti-AGA Antibody

Target Information

Target Protein: Aspartylglucosaminidase
Target Gene: AGA
Alternative Gene Names: ASRG

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human AGA.

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
SSPLPLVVNTWPFKNATEAAWRALASGGSALDAVESGCAMCEREQCDGSV
```

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000031521	86%
Rat	ENSRNOG00000000108	84%

Antibody Characteristics

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet