CacheBy
Atlas Antibodies Anti-AFDN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AFDN Antibody

상품 한눈에 보기

Human AFDN 단백질을 타깃으로 하는 폴리클로날 토끼 항체. IHC 및 ICC 응용에 적합. PrEST 항원으로 친화 정제됨. Human 반응성 검증 완료. 안정한 PBS/glycerol 버퍼에 보존제 포함.

카탈로그번호
HPA049868-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049868-100 Anti-AFDN Antibody, afadin, adherens junction formation factor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049868-25 Anti-AFDN Antibody, afadin, adherens junction formation factor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AFDN Antibody

Anti-AFDN Antibody

Target Information

  • Target Protein: afadin, adherens junction formation factor
  • Target Gene: AFDN
  • Alternative Gene Names: AF-6, AF6, MLLT4
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human AFDN.

Open Datasheet

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    ASHVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQQPDYRRQESRTQD
  • Verified Species Reactivity: Human
  • Interspecies Information:
    • Rat ENSRNOG00000023753 (87%)
    • Mouse ENSMUSG00000068036 (84%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.