
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AFTPH Antibody
상품 한눈에 보기
Human AFTPH 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 재조합 발현 검증을 완료했으며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증되었고, 높은 종간 서열 유사성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA034991-100 Anti-AFTPH Antibody, aftiphilin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034991-25 Anti-AFTPH Antibody, aftiphilin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AFTPH Antibody
Anti-AFTPH Antibody
Target Protein: aftiphilin
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Validated Applications: IHC, WB (Recombinant Expression), ICC
Product Description
Polyclonal antibody against human AFTPH (aftiphilin).
Validated for use in immunohistochemistry (IHC), western blot (WB) with recombinant expression, and immunocytochemistry (ICC).
Recombinant expression validation in WB using target protein overexpression.
Alternative Gene Names
FLJ20080, FLJ23793, MGC33965, Nbla10388
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | aftiphilin |
| Target Gene | AFTPH |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DSVPNIQDDCNGFQDSDDFADFSSAGPSQVVDWNAFEDEQKDSCSWAAFGDQQATESHHRKEAWQSHRTDENIDTPGTPKTHSVP |
Species Reactivity
| 검증된 종 | Human |
|---|---|
| Ortholog Identity | Rat ENSRNOG00000005411 (84%) Mouse ENSMUSG00000049659 (79%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
- Open Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



