
Atlas Antibodies Anti-LRRC14B Antibody
상품 한눈에 보기
Human LRRC14B 단백질을 인식하는 토끼 다클론 항체로, 면역조직화학 등 다양한 연구용 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증된 반응성을 보입니다. 글리세롤 기반 완충액에 보존되어 안정적입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LRRC14B Antibody
Target: Leucine Rich Repeat Containing 14B (LRRC14B)
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human LRRC14B.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Leucine Rich Repeat Containing 14B |
| Target Gene | LRRC14B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LRCIEFPVPKDCYPEGAAYPQDELAMSKFNQQKYDEIAEELRAVLLRADREDIQVSTPLFGSFDPDIQETSNELGAFLLQAFKTAL |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000021579 (88%), Rat ENSRNOG00000028357 (86%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LRRC14B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC14B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC10B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRR1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.