CacheBy
Atlas Antibodies Anti-LRRC15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRC15 Antibody

상품 한눈에 보기

Human LRRC15 단백질에 대한 고품질 폴리클로날 항체. Rabbit 호스트에서 생산되었으며 IgG 아이소타입. IHC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035503-100 Anti-LRRC15 Antibody, leucine rich repeat containing 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035503-25 Anti-LRRC15 Antibody, leucine rich repeat containing 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRC15 Antibody

Anti-LRRC15 Antibody

Target: leucine rich repeat containing 15 (LRRC15)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human LRRC15.


Alternative Gene Names

  • LIB

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein leucine rich repeat containing 15
Target Gene LRRC15
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NWLLLNQPRLGTDTVPVCFSPANVRGQSLIIINVNVAVPSVHVPEVPSYPETPWYPDTPSYPDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVW

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 항원 서열 일치율
Rat ENSRNOG00000038539 73%
Mouse ENSMUSG00000052316 65%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.