
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRRC14B Antibody
상품 한눈에 보기
Human LRRC14B 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 Affinity Purification 되었으며, 고순도 IgG 형태로 제공됩니다. PBS 및 glycerol buffer에 보존되어 안정적입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038047-100 Anti-LRRC14B Antibody, leucine rich repeat containing 14B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038047-25 Anti-LRRC14B Antibody, leucine rich repeat containing 14B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRRC14B Antibody
Anti-LRRC14B Antibody
Target: leucine rich repeat containing 14B (LRRC14B)
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human LRRC14B
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LRCIEFPVPKDCYPEGAAYPQDELAMSKFNQQKYDEIAEELRAVLLRADREDIQVSTPLFGSFDPDIQETSNELGAFLLQAFKTAL
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Mouse (ENSMUSG00000021579): 88%
- Rat (ENSRNOG00000028357): 86%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



