CacheBy
Atlas Antibodies Anti-ADHFE1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADHFE1 Antibody

상품 한눈에 보기

인간 ADHFE1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. RNA-seq 기반 직교 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023062-100 Anti-ADHFE1 Antibody, alcohol dehydrogenase, iron containing, 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023062-25 Anti-ADHFE1 Antibody, alcohol dehydrogenase, iron containing, 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADHFE1 Antibody

Anti-ADHFE1 Antibody

Target: alcohol dehydrogenase, iron containing, 1 (ADHFE1)
Type: Polyclonal Antibody against Human ADHFE1
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation using RNA-seq data comparison between high and low expression tissues)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody targeting human ADHFE1, validated through orthogonal comparison of protein and RNA expression data.


Alternative Gene Names

ADHFe1, FLJ32430


Target Information

항목 내용
Target Protein alcohol dehydrogenase, iron containing, 1
Target Gene ADHFE1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGLAAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMKL
Verified Species Reactivity Human
Interspecies Identity Mouse (86%), Rat (85%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Open Datasheet (PDF)

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.