
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ADHFE1 Antibody
상품 한눈에 보기
인간 ADHFE1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. RNA-seq 기반 직교 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA023062-100 Anti-ADHFE1 Antibody, alcohol dehydrogenase, iron containing, 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023062-25 Anti-ADHFE1 Antibody, alcohol dehydrogenase, iron containing, 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ADHFE1 Antibody
Anti-ADHFE1 Antibody
Target: alcohol dehydrogenase, iron containing, 1 (ADHFE1)
Type: Polyclonal Antibody against Human ADHFE1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation using RNA-seq data comparison between high and low expression tissues)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody targeting human ADHFE1, validated through orthogonal comparison of protein and RNA expression data.
Alternative Gene Names
ADHFe1, FLJ32430
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | alcohol dehydrogenase, iron containing, 1 |
| Target Gene | ADHFE1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGLAAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMKL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (86%), Rat (85%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Open Datasheet (PDF)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



