CacheBy
Atlas Antibodies Anti-ADGRV1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADGRV1 Antibody

상품 한눈에 보기

인간 ADGRV1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성을 가지며, 높은 종간 서열 유사성을 보유. 40% 글리세롤 기반 PBS 버퍼에 보존제 함유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067503-100 Anti-ADGRV1 Antibody, adhesion G protein-coupled receptor V1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067503-25 Anti-ADGRV1 Antibody, adhesion G protein-coupled receptor V1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADGRV1 Antibody

Anti-ADGRV1 Antibody

Target: adhesion G protein-coupled receptor V1 (ADGRV1)
Type: Polyclonal Antibody against Human ADGRV1


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting human adhesion G protein-coupled receptor V1 (ADGRV1).


Alternative Gene Names

DKFZp761P0710, FEB4, GPR98, KIAA0686, MASS1, USH2C, VLGR1

Open Datasheet


Antigen Information

Antigen Sequence (PrEST antigen):
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

ESIIVSLVYTEGGSRILPSSDTVRVNILANDNVAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFFPEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAA

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000069170 87%
Rat ENSRNOG00000016306 85%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.