CacheBy
Atlas Antibodies Anti-ADH6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADH6 Antibody

상품 한눈에 보기

인간 ADH6 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, 정제된 PrEST 항원을 사용해 높은 특이성과 재현성을 보장. 인간에 반응하며, 쥐와 생쥐에 대한 교차 반응성 정보 제공. 40% 글리세롤 및 PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA067946-100 Anti-ADH6 Antibody, alcohol dehydrogenase 6 (class V) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067946-25 Anti-ADH6 Antibody, alcohol dehydrogenase 6 (class V) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADH6 Antibody

Anti-ADH6 Antibody

Target: Alcohol dehydrogenase 6 (class V)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
  • WB (Independent antibody validation): Protein expression confirmed by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against human ADH6.


Alternative Gene Names

  • ADH-5

Target Information

항목 내용
Target Protein Alcohol dehydrogenase 6 (class V)
Target Gene ADH6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEG
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000012436 (61%), Mouse ENSMUSG00000074206 (50%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
IHC Orthogonal Tooltip
WB Independent
WB Independent Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.