
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LGALS3BP Antibody
상품 한눈에 보기
인간 LGALS3BP 단백질을 인식하는 폴리클로날 항체. IHC 및 WB 분석에 적합하며 RNA-seq 데이터 기반의 정교한 Orthogonal 검증 수행. 토끼 유래 IgG로 PrEST 항원 친화 정제. 다양한 종 간 교차 반응 정보 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA000554-100 Anti-LGALS3BP Antibody, lectin, galactoside-binding, soluble, 3 binding protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000554-25 Anti-LGALS3BP Antibody, lectin, galactoside-binding, soluble, 3 binding protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LGALS3BP Antibody
Anti-LGALS3BP Antibody
Target: lectin, galactoside-binding, soluble, 3 binding protein (LGALS3BP)
Type: Polyclonal Antibody against Human LGALS3BP
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody raised in rabbit against human LGALS3BP using a recombinant protein epitope signature tag (PrEST) antigen.
Alternative Gene Names
90K, BTBD17B, CyCAP, gp90, M2BP, MAC-2-BP, TANGO10B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | lectin, galactoside-binding, soluble, 3 binding protein |
| Target Gene | LGALS3BP |
| Antigen Sequence | RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000033880 (67%), Rat ENSRNOG00000003217 (66%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



