
Atlas Antibodies Anti-LGALS3BP Antibody
인간 LGALS3BP 단백질을 인식하는 폴리클로날 항체. IHC 및 WB 분석에 적합하며 RNA-seq 데이터 기반의 정교한 Orthogonal 검증 수행. 토끼 유래 IgG로 PrEST 항원 친화 정제. 다양한 종 간 교차 반응 정보 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LGALS3BP Antibody
Target: lectin, galactoside-binding, soluble, 3 binding protein (LGALS3BP)
Type: Polyclonal Antibody against Human LGALS3BP
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody raised in rabbit against human LGALS3BP using a recombinant protein epitope signature tag (PrEST) antigen.
Alternative Gene Names
90K, BTBD17B, CyCAP, gp90, M2BP, MAC-2-BP, TANGO10B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | lectin, galactoside-binding, soluble, 3 binding protein |
| Target Gene | LGALS3BP |
| Antigen Sequence | RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000033880 (67%), Rat ENSRNOG00000003217 (66%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LGALS4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LGALS3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LGALS3BP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LGALS8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LGALS4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|