CacheBy
Atlas Antibodies Anti-LGALS3BP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LGALS3BP Antibody

상품 한눈에 보기

인간 LGALS3BP 단백질을 인식하는 폴리클로날 항체. IHC 및 WB 분석에 적합하며 RNA-seq 데이터 기반의 정교한 Orthogonal 검증 수행. 토끼 유래 IgG로 PrEST 항원 친화 정제. 다양한 종 간 교차 반응 정보 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000554-100 Anti-LGALS3BP Antibody, lectin, galactoside-binding, soluble, 3 binding protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000554-25 Anti-LGALS3BP Antibody, lectin, galactoside-binding, soluble, 3 binding protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LGALS3BP Antibody

Anti-LGALS3BP Antibody

Target: lectin, galactoside-binding, soluble, 3 binding protein (LGALS3BP)
Type: Polyclonal Antibody against Human LGALS3BP


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal antibody raised in rabbit against human LGALS3BP using a recombinant protein epitope signature tag (PrEST) antigen.


Alternative Gene Names

90K, BTBD17B, CyCAP, gp90, M2BP, MAC-2-BP, TANGO10B


Target Information

항목 내용
Target Protein lectin, galactoside-binding, soluble, 3 binding protein
Target Gene LGALS3BP
Antigen Sequence RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000033880 (67%), Rat ENSRNOG00000003217 (66%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.