
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LGALS4 Antibody
상품 한눈에 보기
Human LGALS4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal Validation을 통해 검증됨. Affinity purification 방식으로 제조되었으며, 다양한 조직에서의 단백질 발현 비교에 적합. PBS/glycerol buffer에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031184-100 Anti-LGALS4 Antibody, lectin, galactoside-binding, soluble, 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031184-25 Anti-LGALS4 Antibody, lectin, galactoside-binding, soluble, 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LGALS4 Antibody
Anti-LGALS4 Antibody
Target Protein: lectin, galactoside-binding, soluble, 4
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human LGALS4.
Alternative Gene Names
- GAL4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | lectin, galactoside-binding, soluble, 4 |
| Target Gene | LGALS4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000020338 (72%), Mouse ENSMUSG00000053964 (69%) |
Antigen Sequence:
PGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSS
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Related Document
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



