CacheBy
Atlas Antibodies Anti-LGALS4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LGALS4 Antibody

상품 한눈에 보기

Human LGALS4 단백질을 표적으로 하는 rabbit polyclonal 항체로, IHC에서 RNA-seq 데이터와 비교한 orthogonal validation을 거침. PrEST 항원을 사용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031186-100 Anti-LGALS4 Antibody, lectin, galactoside-binding, soluble, 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031186-25 Anti-LGALS4 Antibody, lectin, galactoside-binding, soluble, 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LGALS4 Antibody

Anti-LGALS4 Antibody

lectin, galactoside-binding, soluble, 4


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human LGALS4


Alternative Gene Names

  • GAL4

Open Datasheet


Target Information

항목 내용
Target Protein lectin, galactoside-binding, soluble, 4
Target Gene LGALS4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000020338 (72%)
Mouse ENSMUSG00000053964 (69%)

Antigen Sequence:

PGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.