
Atlas Antibodies Anti-LETM2 Antibody
상품 한눈에 보기
Human LETM2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human 반응성이 검증되어 연구용으로 적합합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LETM2 Antibody
Target: leucine zipper-EF-hand containing transmembrane protein 2 (LETM2)
Type: Polyclonal Antibody against Human LETM2
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human LETM2 (leucine zipper-EF-hand containing transmembrane protein 2).
Alternative Gene Names
- FLJ25409
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine zipper-EF-hand containing transmembrane protein 2 |
| Target Gene | LETM2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLIDVKPKPIEIPLSGEAPKTDILVELPTFTE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000026180 (76%), Mouse ENSMUSG00000037363 (71%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LFNG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LETMD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LETM2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LEUTX Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LETM1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.