CacheBy
Atlas Antibodies Anti-LETMD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LETMD1 Antibody

상품 한눈에 보기

Human LETMD1 단백질을 표적으로 하는 폴리클로날 항체. Rabbit에서 생성된 IgG 형태로, Affinity purification 방식 적용. 면역세포화학(ICC) 등 다양한 응용에 적합. PBS와 glycerol buffer로 안정화되어 장기 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA074361-100 Anti-LETMD1 Antibody, LETM1 domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074361-25 Anti-LETMD1 Antibody, LETM1 domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LETMD1 Antibody

Anti-LETMD1 Antibody

Target: LETM1 domain containing 1
Supplier: Atlas Antibodies

면역세포화학 (ICC)

Product Description

Polyclonal antibody against Human LETMD1.

Alternative Gene Names

  • HCCR1

Open Datasheet (PDF)

Target Information

  • Target Protein: LETM1 domain containing 1
  • Target Gene: LETMD1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000029855 66%
Mouse ENSMUSG00000037353 59%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 조건에 맞는 최적 농도는 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.