CacheBy
Atlas Antibodies Anti-LETM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LETM1 Antibody

상품 한눈에 보기

Human LETM1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 이용해 높은 특이성과 재현성을 보장. PBS/glycerol 버퍼에 보존되어 장기 안정성 우수.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011100-100 Anti-LETM1 Antibody, leucine zipper-EF-hand containing transmembrane protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011100-25 Anti-LETM1 Antibody, leucine zipper-EF-hand containing transmembrane protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LETM1 Antibody

Anti-LETM1 Antibody

leucine zipper-EF-hand containing transmembrane protein 1


  • IHC (Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues)
  • WB
  • ICC

Product Description

Polyclonal antibody against Human LETM1

Open Datasheet


Target Information

항목 내용
Target Protein leucine zipper-EF-hand containing transmembrane protein 1
Target Gene LETM1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SKTGEEKYVEESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVAEIVATLE
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000016427 (79%), Mouse ENSMUSG00000005299 (78%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.