CacheBy
Atlas Antibodies Anti-LCMT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LCMT2 Antibody

상품 한눈에 보기

Human LCMT2 단백질을 타깃으로 하는 고품질 폴리클로날 항체. Rabbit 호스트에서 생산되었으며 IgG 아이소타입. IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039401-100 Anti-LCMT2 Antibody, leucine carboxyl methyltransferase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039401-25 Anti-LCMT2 Antibody, leucine carboxyl methyltransferase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LCMT2 Antibody

Anti-LCMT2 Antibody

Target: leucine carboxyl methyltransferase 2 (LCMT2)

면역조직화학 (IHC) 등 다양한 실험 응용에 적합

Product Description

Polyclonal Antibody against Human LCMT2

Alternative Gene Names

KIAA0547, MGC9534, PPM2, TYW4

Open Datasheet

Target Information

항목 내용
Target Protein leucine carboxyl methyltransferase 2
Target Gene LCMT2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000074890 (69%), Rat ENSRNOG00000043002 (68%)

Antigen Sequence

FKSEDNNTEDLKVTITKAGRKDDSTLCCWRHSTTEVSCQNQEYLFVYGGRSVVEPVLSDWHFLHVGTMAWVRIPVEGEVPEARHS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.