CacheBy
Atlas Antibodies Anti-LCN15 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LCN15 Antibody

상품 한눈에 보기

인간 LCN15 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정교한 단백질 발현 검증에 적합. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원으로 친화 정제됨. Human에 특이적이며 실험 조건 최적화 필요.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060584-100 Anti-LCN15 Antibody, lipocalin 15 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060584-25 Anti-LCN15 Antibody, lipocalin 15 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LCN15 Antibody

Anti-LCN15 Antibody

Target Protein: lipocalin 15
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human LCN15


Alternative Gene Names

PRO6093, UNQ2541

Open Datasheet


Specifications

항목 내용
Target Protein lipocalin 15
Target Gene LCN15
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FAVLYIYKELEGALSTMVQLYSRTQDVSPQALKAFQDFYPTLGLPEDMMVMLPQSDACNPESKE
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000028701 (36%), Mouse ENSMUSG00000026936 (34%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.