CacheBy
Atlas Antibodies Anti-LCOR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LCOR Antibody

상품 한눈에 보기

Human LCOR 단백질을 인식하는 토끼 폴리클로날 항체로, Western blot 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 40% 글리세롤 및 PBS 완충액 포함, 나트륨 아지드 보존제 첨가.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031428-100 Anti-LCOR Antibody, ligand dependent nuclear receptor corepressor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031428-25 Anti-LCOR Antibody, ligand dependent nuclear receptor corepressor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LCOR Antibody

Anti-LCOR Antibody

Target: Ligand dependent nuclear receptor corepressor (LCOR)
Supplier: Atlas Antibodies


Western Blot (WB)


Product Description

Polyclonal antibody against Human LCOR


Alternative Gene Names

FLJ38026, KIAA1795, MLR2

Open Datasheet


Target Information

항목 내용
Target Protein Ligand dependent nuclear receptor corepressor
Target Gene LCOR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000025019 (94%), Rat ENSRNOG00000042679 (93%)

Antigen Sequence:
HGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWE


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.