Thermo Fisher Scientific UCP2 Polyclonal Antibody
Thermo Fisher Scientific의 UCP2 Polyclonal Antibody는 인간, 마우스, 랫트 반응성을 가지며 Western blot에 적합합니다. Rabbit IgG 폴리클로날 항체로, 항원 친화 크로마토그래피로 정제되었습니다. 미토콘드리아 UCP2 단백질 연구용으로 사용되며, 동결 건조 형태로 제공됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- View 2 publications
Miscellaneous PubMed (Misc)
- Tested Dilution: –
- View 1 publication
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human UCP2 (134–170aa AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747317 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They reduce mitochondrial membrane potential in mammalian cells.
UCP2 gene is expressed in many tissues, with highest expression in skeletal muscle. UCP2 is thought to play a role in non-shivering thermogenesis, obesity, and diabetes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일명: PA5-80203_UCP2_P55851-1_Rabbit.svg, PA5-80203_UCP2_P55851-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific UHRF2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific UHRF1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific UCP2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific UBE2Q2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific UBD Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|