Thermo Fisher Scientific UCP2 Polyclonal Antibody
Thermo Fisher Scientific의 UCP2 Polyclonal Antibody는 인간, 마우스, 랫트 반응성을 가지며 Western blot에 적합합니다. Rabbit IgG 폴리클로날 항체로, 항원 친화 크로마토그래피로 정제되었습니다. 미토콘드리아 UCP2 단백질 연구용으로 사용되며, 동결 건조 형태로 제공됩니다.
- 카탈로그번호
- PA580203
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific UCP2 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
- View 2 publications
Miscellaneous PubMed (Misc)
- Tested Dilution: –
- View 1 publication
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human UCP2 (134–170aa AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747317 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They reduce mitochondrial membrane potential in mammalian cells.
UCP2 gene is expressed in many tissues, with highest expression in skeletal muscle. UCP2 is thought to play a role in non-shivering thermogenesis, obesity, and diabetes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일명: PA5-80203_UCP2_P55851-1_Rabbit.svg, PA5-80203_UCP2_P55851-1_Rabbit_PDP.jpeg)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.