CacheBy
Thermo Fisher Scientific UBE2Q2 Polyclonal Antibody
원본

Thermo Fisher Scientific UBE2Q2 Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific의 UBE2Q2 Polyclonal Antibody는 인간 UBE2Q2 단백질을 인식하는 토끼 유래 IgG 항체입니다. Western blot, IHC, ICC, Flow Cytometry 등 다양한 응용에 적합하며, 고순도 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용 가능합니다.

카탈로그번호
PA580202
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 02:55
Thermo Fisher Scientific PA580202 UBE2Q2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific UBE2Q2 Polyclonal Antibody

Applications 및 권장 희석 배율

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC-P) 0.5–1 µg/mL
Immunocytochemistry (ICC/IF) 2 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human UBE2Q2 (83–123aa LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2747316

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

UBE2Q2는 E1 복합체로부터 유비퀴틴을 받아 다른 단백질에 공유 결합시킵니다. In vitro에서 Lys-48 연결된 폴리유비퀴틴화를 촉진합니다. [UniProt]

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.