Thermo Fisher Scientific KLF10 Monoclonal Antibody (2C9)
KLF10 단백질을 인식하는 Thermo Fisher Scientific의 Mouse Monoclonal Antibody(2C9). Western blot 및 ELISA에 적합하며, Human 시료에 반응. Affinity chromatography로 정제된 무보존액 액상 항체. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific KLF10 Monoclonal Antibody (2C9)
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1–5 µg/mL |
| ELISA | 10 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG2a, kappa |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 2C9 |
| Immunogen | KLF10 (AAH11538.1, 1–110 a.a.) partial recombinant protein with GST tag (GST tag MW: 26 kDa) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | See Label |
| Purification | Affinity chromatography |
| Storage buffer | PBS, pH 7.4 |
| Contains | No preservative |
| Storage conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
Sequence of this protein:
MEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPA FCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKS
Target Information
KLF10 is a nuclear protein belonging to the Sp1 C2H2-type zinc-finger protein family with three C2H2-type zinc fingers.
It acts as a transcriptional repressor regulating cell growth and apoptosis. KLF10 binds to the consensus sequence 5'-GGTGTG-3' and is induced by TGF-beta, linking TGF-beta-mediated signaling to regulation of pancreatic epithelial cell growth.
It promotes apoptosis via the mitochondrial pathway and may inhibit Smad7 expression in bronchial epithelial cells.
KLF10 is ubiquitously expressed in most tissues and may mediate up-regulation of TGFBI in VHL-deficient tumors and other cancers. Overexpression has been associated with renal clear cell carcinoma and other tumors.
KLF11, a related zinc finger transcription factor, binds to SP1-like sequences in epsilon- and gamma-globin gene promoters, inhibiting cell growth and inducing apoptosis. Defects in this gene can cause maturity-onset diabetes of the young type 7 (MODY7). Three transcript variants encoding two different isoforms have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.