Thermo Fisher Scientific IDO Polyclonal Antibody
IDO1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC, Flow Cytometry에 사용 가능. 인간 시료에 반응하며 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific IDO Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL | - |
| Immunocytochemistry (ICC/IF) | 2 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells | - |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to N-terminus of human IDO1 (37–69aa: NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746553 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
IDO1 (Indoleamine 2,3-dioxygenase 1) is an intracellular heme-containing enzyme that catalyzes the oxidative cleavage of the indole ring in regulatory molecules such as tryptophan, serotonin, and melatonin. This reaction initiates the formation of biologically active metabolites known as kynurenines.
IDO1 is broadly expressed in human tissues, macrophages, and dendritic cells. During inflammation, interferons (IFNs) induce IDO1 expression, contributing to antimicrobial defense by depleting tryptophan and inhibiting pathogen growth.
Additionally, IDO1 plays a crucial role in immunoregulation during infection, pregnancy, autoimmunity, transplantation, and cancer.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.