Thermo Fisher Scientific IDO Polyclonal Antibody
IDO1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC, Flow Cytometry에 사용 가능. 인간 시료에 반응하며 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL | - |
| Immunocytochemistry (ICC/IF) | 2 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells | - |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to N-terminus of human IDO1 (37–69aa: NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746553 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
IDO1 (Indoleamine 2,3-dioxygenase 1) is an intracellular heme-containing enzyme that catalyzes the oxidative cleavage of the indole ring in regulatory molecules such as tryptophan, serotonin, and melatonin. This reaction initiates the formation of biologically active metabolites known as kynurenines.
IDO1 is broadly expressed in human tissues, macrophages, and dendritic cells. During inflammation, interferons (IFNs) induce IDO1 expression, contributing to antimicrobial defense by depleting tryptophan and inhibiting pathogen growth.
Additionally, IDO1 plays a crucial role in immunoregulation during infection, pregnancy, autoimmunity, transplantation, and cancer.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific IFITM1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Iduronate 2 Sulfatase Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IDO Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ICOS (CD278) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ICOS (CD278) Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|