CacheBy
Thermo Fisher Scientific c-Rel Polyclonal Antibody
원본

Thermo Fisher Scientific c-Rel Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific의 c-Rel Polyclonal Antibody는 인간, 마우스, 랫트 시료에 반응하며 Western blot 및 IHC(P) 분석에 적합합니다. 항원 친화 크로마토그래피로 정제된 토끼 IgG 항체로, 동결건조 형태로 제공되며 재구성 시 500 µg/mL 농도를 제공합니다. 연구용 전용 제품입니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오전 03:27
Thermo Fisher Scientific PA579922 c-Rel Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific c-Rel Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268–306 aa: DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions –20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2747037

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

The REL gene encodes c-Rel, a transcription factor belonging to the Rel/NFκB family, which also includes RELA, RELB, NFKB1, and NFKB2. These proteins share a conserved Rel domain, responsible for DNA binding, dimerization, nuclear localization, and interaction with NFκB inhibitors (Belguise and Sonenshein, 2007).


For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.