Thermo Fisher Scientific c-Rel Polyclonal Antibody
Thermo Fisher Scientific의 c-Rel Polyclonal Antibody는 인간, 마우스, 랫트 시료에 반응하며 Western blot 및 IHC(P) 분석에 적합합니다. 항원 친화 크로마토그래피로 정제된 토끼 IgG 항체로, 동결건조 형태로 제공되며 재구성 시 500 µg/mL 농도를 제공합니다. 연구용 전용 제품입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268–306 aa: DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747037 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The REL gene encodes c-Rel, a transcription factor belonging to the Rel/NFκB family, which also includes RELA, RELB, NFKB1, and NFKB2. These proteins share a conserved Rel domain, responsible for DNA binding, dimerization, nuclear localization, and interaction with NFκB inhibitors (Belguise and Sonenshein, 2007).
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific RNH1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific RNF43 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific c-Rel Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific RFC1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific RNF186 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|