원본
Thermo Fisher Scientific c-Rel Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 c-Rel Polyclonal Antibody는 인간, 마우스, 랫트 시료에 반응하며 Western blot 및 IHC(P) 분석에 적합합니다. 항원 친화 크로마토그래피로 정제된 토끼 IgG 항체로, 동결건조 형태로 제공되며 재구성 시 500 µg/mL 농도를 제공합니다. 연구용 전용 제품입니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오전 03:27
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579922 c-Rel Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific c-Rel Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268–306 aa: DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747037 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The REL gene encodes c-Rel, a transcription factor belonging to the Rel/NFκB family, which also includes RELA, RELB, NFKB1, and NFKB2. These proteins share a conserved Rel domain, responsible for DNA binding, dimerization, nuclear localization, and interaction with NFκB inhibitors (Belguise and Sonenshein, 2007).
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific RNH1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific RNF43 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific RFC1 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific RNF186 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.