Thermo Fisher Scientific Beta III Tubulin Polyclonal Antibody
신경세포 특이적 마커로 사용되는 Beta III Tubulin을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC/IF, Flow cytometry 등 다양한 응용 가능. 고순도 항원 친화 크로마토그래피 정제 및 동결건조 형태로 제공.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Beta III Tubulin Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to the C-terminus of human Beta Tubulin (383–412aa: EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747312 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Beta III Tubulin isoform is dominantly expressed in cells of neuronal origin and is one of the earliest markers of neuronal differentiation. It serves as a specific probe for neuronal cells and tumors derived from these cells. Although primarily found in neuronal cells, it is also detected in Sertoli cells of the testis and transiently in non-neuronal embryonic tissues.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-80198_Beta_III_Tubulin_Q13509-1_Rabbit.svg, PA5-80198_Beta_III_Tubulin_Q13509-1_Rabbit_PDP.jpeg)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.