Thermo Fisher Scientific Beta III Tubulin Polyclonal Antibody
신경세포 특이적 마커로 사용되는 Beta III Tubulin을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC/IF, Flow cytometry 등 다양한 응용 가능. 고순도 항원 친화 크로마토그래피 정제 및 동결건조 형태로 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 2–5 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to the C-terminus of human Beta Tubulin (383–412aa: EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747312 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Beta III Tubulin isoform is dominantly expressed in cells of neuronal origin and is one of the earliest markers of neuronal differentiation. It serves as a specific probe for neuronal cells and tumors derived from these cells. Although primarily found in neuronal cells, it is also detected in Sertoli cells of the testis and transiently in non-neuronal embryonic tissues.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-80198_Beta_III_Tubulin_Q13509-1_Rabbit.svg, PA5-80198_Beta_III_Tubulin_Q13509-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific UBA2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TSLP Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Beta III Tubulin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TSPAN12 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TSC1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|