CacheBy
Atlas Antibodies Anti-ADGRF4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADGRF4 Antibody

상품 한눈에 보기

인간 ADGRF4 단백질을 인식하는 폴리클로날 항체로, IHC 분석 및 단백질 발현 검증에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 고품질 항체입니다.

카탈로그번호
HPA007131-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007131-100 Anti-ADGRF4 Antibody, adhesion G protein-coupled receptor F4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007131-25 Anti-ADGRF4 Antibody, adhesion G protein-coupled receptor F4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADGRF4 Antibody

Anti-ADGRF4 Antibody

adhesion G protein-coupled receptor F4

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human ADGRF4

Alternative Gene Names

FLJ38076, GPR115, PGR18

Open Datasheet

Target Information

항목 내용
Target Protein adhesion G protein-coupled receptor F4
Target Gene ADGRF4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000023918 (54%), Rat ENSRNOG00000012535 (54%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

QSPEGKPKTGRIQEKCEGPCISSSNCSQPCAKDFHGEIGFTCNQKKWQKSAETCTSLSVEKLFKDSTGASRLSVAAPSIPLHILDFRAPETIESVAQGIRKNCPFDYACITDMVKSSETTSGNIAFIVELLKNISTDLSDNVTR

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.