CacheBy
Atlas Antibodies Anti-ADGRE1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADGRE1 Antibody

상품 한눈에 보기

인간 ADGRE1 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간 반응성이 검증되었으며, 안정적인 PBS/glycerol buffer로 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052809-100 Anti-ADGRE1 Antibody, adhesion G protein-coupled receptor E1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052809-25 Anti-ADGRE1 Antibody, adhesion G protein-coupled receptor E1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADGRE1 Antibody

Anti-ADGRE1 Antibody

Target Information

  • Target Protein: adhesion G protein-coupled receptor E1
  • Target Gene: ADGRE1
  • Alternative Gene Names: EMR1, TM7LN3

Product Description

Polyclonal antibody against Human ADGRE1.

면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMAN

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000004730 (76%)
  • Rat ENSRNOG00000046254 (68%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet
Open Datasheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자 실험 환경에 따라 결정됩니다.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.