CacheBy
Atlas Antibodies Anti-ADGRG6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADGRG6 Antibody

상품 한눈에 보기

인간 ADGRG6 단백질을 인식하는 토끼 폴리클로날 항체입니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 응용에 적합합니다. 인간에 반응하며, 마우스 및 랫트와 부분적 상동성을 가집니다. 안정적인 글리세롤/PBS 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA017346-100 Anti-ADGRG6 Antibody, adhesion G protein-coupled receptor G6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA017346-25 Anti-ADGRG6 Antibody, adhesion G protein-coupled receptor G6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADGRG6 Antibody

Anti-ADGRG6 Antibody

Target: adhesion G protein-coupled receptor G6
Type: Polyclonal antibody against Human ADGRG6


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against human ADGRG6 (adhesion G protein-coupled receptor G6).
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

  • FLJ14937
  • GPR126

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein adhesion G protein-coupled receptor G6
Target Gene ADGRG6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence KRSLEDEPRLVLWALLVYNATNNTNLEGKIIQQKLLKNNESLDEGLRLHTVNVRQLGHCLAMEEPKGYYWPSIQPSEYVLPCPDKPGFSASRICFYNATNPLVTYWGPVD
Verified Species Reactivity Human
Interspecies Identity Mouse (55%), Rat (53%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen

Buffer Information

항목 내용
Composition 40% glycerol, PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.