Atlas Antibodies Anti-ADGRE5 Antibody

상품 한눈에 보기

인간 ADGRE5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합합니다. CD97/TM7LN1 유전자에 대응하며 PrEST 항원으로 친화 정제되었습니다. 인체 반응성 검증 완료, 안정적인 PBS-글리세롤 버퍼에 보존됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA013707-100 Anti-ADGRE5 Antibody, adhesion G protein-coupled receptor E5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA013707-25 Anti-ADGRE5 Antibody, adhesion G protein-coupled receptor E5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: adhesion G protein-coupled receptor E5 (ADGRE5)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human ADGRE5.

CD97, TM7LN1

항목	내용
Target Protein	adhesion G protein-coupled receptor E5
Target Gene	ADGRE5
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000004489 (51%), Mouse ENSMUSG00000002885 (49%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQ

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.