
Atlas Antibodies Anti-ADGRE5 Antibody
상품 한눈에 보기
인간 ADGRE5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합합니다. CD97/TM7LN1 유전자에 대응하며 PrEST 항원으로 친화 정제되었습니다. 인체 반응성 검증 완료, 안정적인 PBS-글리세롤 버퍼에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ADGRE5 Antibody
Target: adhesion G protein-coupled receptor E5 (ADGRE5)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human ADGRE5.
Alternative Gene Names
CD97, TM7LN1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | adhesion G protein-coupled receptor E5 |
| Target Gene | ADGRE5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000004489 (51%), Mouse ENSMUSG00000002885 (49%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Antigen Sequence
RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQ제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ADGRG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADGRG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADGRE5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADGRF3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADGRF1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.