CacheBy
Atlas Antibodies Anti-ADGRE5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ADGRE5 Antibody

상품 한눈에 보기

인간 ADGRE5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합합니다. CD97/TM7LN1 유전자에 대응하며 PrEST 항원으로 친화 정제되었습니다. 인체 반응성 검증 완료, 안정적인 PBS-글리세롤 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA013707-100 Anti-ADGRE5 Antibody, adhesion G protein-coupled receptor E5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013707-25 Anti-ADGRE5 Antibody, adhesion G protein-coupled receptor E5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADGRE5 Antibody

Anti-ADGRE5 Antibody

Target: adhesion G protein-coupled receptor E5 (ADGRE5)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human ADGRE5.

Alternative Gene Names

CD97, TM7LN1

Open Datasheet

Target Information

항목 내용
Target Protein adhesion G protein-coupled receptor E5
Target Gene ADGRE5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000004489 (51%), Mouse ENSMUSG00000002885 (49%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQ

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.