CacheBy
Atlas Antibodies Anti-ADGRF3 Antibody
원본

Atlas Antibodies Anti-ADGRF3 Antibody

상품 한눈에 보기

Human ADGRF3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. GPR113, PGR23 등 대체 유전자명과 교차 반응 정보 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA044500-100 Anti-ADGRF3 Antibody, adhesion G protein-coupled receptor F3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044500-25 Anti-ADGRF3 Antibody, adhesion G protein-coupled receptor F3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADGRF3 Antibody

Anti-ADGRF3 Antibody

Target Information

  • Target Protein: adhesion G protein-coupled receptor F3
  • Target Gene: ADGRF3
  • Alternative Gene Names: GPR113, hGPCR37, PGR23

면역조직화학 (IHC)

Product Description

Polyclonal Antibody against Human ADGRF3

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

CIPSTNLAYTAAWSPGEGSKASSFNESGSQCFVLAVQRCPMADTTYACDLQSLGLAPLRVPISITIIQDGDITCPEDASVLTWNVTKAGHVAQAPCPESKRGIVRRLCGADG

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000024766 (70%)
  • Mouse ENSMUSG00000067642 (68%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 환경에 따라 결정해야 합니다.

Open Datasheet (PDF)
Material Safety Data Sheet (MSDS)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.