원본

Atlas Antibodies Anti-ADGRF1 Antibody

상품 한눈에 보기

Human ADGRF1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. GPR110 등 대체 유전자 이름으로도 알려져 있습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038438-100 Anti-ADGRF1 Antibody, adhesion G protein-coupled receptor F1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038438-25 Anti-ADGRF1 Antibody, adhesion G protein-coupled receptor F1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: adhesion G protein-coupled receptor F1 (ADGRF1)
Supplier: Atlas Antibodies

Polyclonal antibody against human ADGRF1.

GPR110, hGPCR36, PGR19

항목	내용
Target Protein	adhesion G protein-coupled receptor F1
Target Gene	ADGRF1
Verified Species Reactivity	Human
Interspecies Information	Mouse (66% identity, ENSMUSG00000041293), Rat (28% identity, ENSRNOG00000025603)

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LENISTLVPPTALPLNFSRKFIDWKGIPVNKSQLKRGYSYQIKMCPQNTSIPIRGRVLIGSDQFQRSLPETIISMASLTLGNILPVSKNGNAQVNG

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet