CacheBy
Atlas Antibodies Anti-ADGRF1 Antibody
원본

Atlas Antibodies Anti-ADGRF1 Antibody

상품 한눈에 보기

Human ADGRF1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. GPR110 등 대체 유전자 이름으로도 알려져 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA038438-100 Anti-ADGRF1 Antibody, adhesion G protein-coupled receptor F1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038438-25 Anti-ADGRF1 Antibody, adhesion G protein-coupled receptor F1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ADGRF1 Antibody

Anti-ADGRF1 Antibody

Target: adhesion G protein-coupled receptor F1 (ADGRF1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human ADGRF1.


Alternative Gene Names

GPR110, hGPCR36, PGR19

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein adhesion G protein-coupled receptor F1
Target Gene ADGRF1
Verified Species Reactivity Human
Interspecies Information Mouse (66% identity, ENSMUSG00000041293), Rat (28% identity, ENSRNOG00000025603)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LENISTLVPPTALPLNFSRKFIDWKGIPVNKSQLKRGYSYQIKMCPQNTSIPIRGRVLIGSDQFQRSLPETIISMASLTLGNILPVSKNGNAQVNG

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.