Atlas Antibodies Anti-AARS Antibody

상품 한눈에 보기

인체 AARS(alanyl-tRNA synthetase)을 표적으로 하는 폴리클로날 토끼 IgG 항체로, IHC 및 WB에 적합합니다. PrEST 항원으로 친화 정제되었으며 인간, 생쥐, 랫트에서 반응성이 검증되었습니다. 40% 글리세롤/PBS 버퍼에 보존제로 나트륨 아지드가 포함되어 있습니다.

카탈로그번호: HPA044223-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044223-100 Anti-AARS Antibody, alanyl-tRNA synthetase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044223-25 Anti-AARS Antibody, alanyl-tRNA synthetase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-AARS Antibody

Anti-AARS Antibody

Target: alanyl-tRNA synthetase (AARS)
Type: Polyclonal Antibody against Human AARS

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot, Independent Validation)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody raised in rabbit against human alanyl-tRNA synthetase.

Open Datasheet

Specifications

항목	내용
Target Protein	alanyl-tRNA synthetase
Target Gene	AARS
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	DRASKADVQKRVLEKTKQFIDSNPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKD
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Rat ENSRNOG00000018404 (98%), Mouse ENSMUSG00000031960 (98%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.