
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AARS Antibody
상품 한눈에 보기
인체 AARS(alanyl-tRNA synthetase)을 표적으로 하는 폴리클로날 토끼 IgG 항체로, IHC 및 WB에 적합합니다. PrEST 항원으로 친화 정제되었으며 인간, 생쥐, 랫트에서 반응성이 검증되었습니다. 40% 글리세롤/PBS 버퍼에 보존제로 나트륨 아지드가 포함되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044223-100 Anti-AARS Antibody, alanyl-tRNA synthetase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044223-25 Anti-AARS Antibody, alanyl-tRNA synthetase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AARS Antibody
Anti-AARS Antibody
Target: alanyl-tRNA synthetase (AARS)
Type: Polyclonal Antibody against Human AARS
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Independent Validation)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against human alanyl-tRNA synthetase.
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | alanyl-tRNA synthetase |
| Target Gene | AARS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DRASKADVQKRVLEKTKQFIDSNPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKD |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Rat ENSRNOG00000018404 (98%), Mouse ENSMUSG00000031960 (98%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



